DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTF14

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:192 Identity:63/192 - (32%)
Similarity:87/192 - (45%) Gaps:34/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LDYEYKEMDLLAGDHFKDAFLKK-NPQHTVPLLEDNGALIWDSHAIVCYLVDKYAN-SDELYPRD 90
            ||:|...:|.|||:.....||.. ||...||:|||....:::..||..||.::|.: ...|.|.|
plant    28 LDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQYKDVGTNLLPDD 92

  Fly    91 LVLRA------QVDQRLFFD-ASILFMSLRNVSIPY--FLRQVSLVP--KEKVDNIKDAYGHLEN 144
            ...||      :||...|.. ||.|...|  :..||  .....:.|.  |||:..:.:.|   |.
plant    93 PKKRAIMSMWMEVDSNQFLPIASTLIKEL--IINPYQGLATDDTAVQENKEKLSEVLNIY---ET 152

  Fly   145 FLGDNPYLTGSQLTIADLCCGATASSLAAV-----LDLDELK-----YPKVAAWFERLSKLP 196
            .||::|||.|...::|||      ..||.:     .|.:|||     .|.||||.|::...|
plant   153 RLGESPYLAGESFSLADL------HHLAPIDYLLNTDEEELKNLIYSRPNVAAWVEKMKMRP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 62/190 (33%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/50 (40%)
GST_C_Delta_Epsilon 94..209 CDD:198287 39/124 (31%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 20/51 (39%)
GST_C_Phi 94..214 CDD:198296 39/126 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.