DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTF6

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:218 Identity:51/218 - (23%)
Similarity:88/218 - (40%) Gaps:49/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHA 71
            ::|...|...|...:.|...|:|:|:..::|..|:|.|:.|:.:||...||..||....|::|.|
plant     6 VFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRA 70

  Fly    72 IVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSL----------------RNVSIPYF 120
            |..|:..::::..    .:|:...:       |.:|:.|.:                ..|..|.:
plant    71 ITQYIAHEFSDKG----NNLLSTGK-------DMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLY 124

  Fly   121 --LRQVSLVPKE--KVDNIKDAYGHLENFLGDNPYLTGSQLTIADL--------CCGATASSLAA 173
              ....::|.:|  |:..:.|.|.|.   ||::.||.....|:.||        ..|.....|  
plant   125 GMTTDKTVVEEEEAKLAKVLDVYEHR---LGESKYLASDHFTLVDLHTIPVIQYLLGTPTKKL-- 184

  Fly   174 VLDLDELKYPKVAAWFERLSKLP 196
               .||  .|.|:||...::..|
plant   185 ---FDE--RPHVSAWVADITSRP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 50/216 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/70 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 27/131 (21%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 23/70 (33%)
GST_C_Phi 91..208 CDD:198296 27/129 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.