DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTF4

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:208 Identity:45/208 - (21%)
Similarity:74/208 - (35%) Gaps:33/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHA 71
            ::|...|...|.....|....|.||...:.|..|:|..:.||..||...||:.||....:::|.|
plant    39 VHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRA 103

  Fly    72 IVCYLVDKYANS------------DELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIP-YFLRQ 123
            |..|:.  |.:|            :.:....:.:..:..|   ||.....::...|..| |.|..
plant   104 ITQYIA--YVHSSRGTQLLNLRSHETMATLTMWMEIEAHQ---FDPPASKLTWEQVIKPIYGLET 163

  Fly   124 VSLVPKEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADL--------CCGATASSLAAVLDLDEL 180
            ...:.||....::......|..|.::.:|..:..|:.||        ..|.....|..       
plant   164 DQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGTPTKKLFE------- 221

  Fly   181 KYPKVAAWFERLS 193
            |..||..|.:.::
plant   222 KRSKVRKWVDEIT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 45/208 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/70 (31%)
GST_C_Delta_Epsilon 94..209 CDD:198287 21/109 (19%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 22/69 (32%)
GST_C_Phi 126..243 CDD:198296 21/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.