DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Clic4

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:165 Identity:33/165 - (20%)
Similarity:61/165 - (36%) Gaps:48/165 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FLKKNPQHTVPLLEDNGALIWDSHAIVCYLVDKYANSDELYPRDLVLRAQ-VDQRLFFDASILFM 110
            :||.:|:|.    |.|.|.:........|:.:....::|...|.|:...| :|:.|         
  Rat   104 YLKLSPKHP----ESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYL--------- 155

  Fly   111 SLRNVSIPYFLRQVSLVPKEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVL 175
               |..:|      ..:.:..:::||.:         ...:|.|.::|:||  |..         
  Rat   156 ---NSPLP------GEIDENSMEDIKSS---------TRRFLDGDEMTLAD--CNL--------- 191

  Fly   176 DLDELKYPKVAAWFERLSKLPHYEEDNLRGLKKYI 210
             |.:|...||.|...|...:|    ..:.|:.:|:
  Rat   192 -LPKLHIVKVVAKKYRNFDIP----KGMTGIWRYL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 30/149 (20%)
GST_N_Delta_Epsilon 5..78 CDD:239343 8/30 (27%)
GST_C_Delta_Epsilon 94..209 CDD:198287 21/115 (18%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101
GST_N_CLIC 14..104 CDD:239359 33/165 (20%)
O-ClC 17..252 CDD:129941 33/165 (20%)
GST_C_family 111..251 CDD:295467 30/158 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.