DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTT2

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:223 Identity:66/223 - (29%)
Similarity:99/223 - (44%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLVLYGMDISPPVRA----CKLTLRALNLDYEYKEMDLLAG--DHFKDAFLKKNPQHTVPLLEDN 62
            ||.:|...:|.|.||    ||:.      :.::.|:.:..|  ......|.:.||...||.:.|.
plant     2 KLKVYADRMSQPSRAVLIFCKVN------EIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDG 60

  Fly    63 GALIWDSHAIVCYLVDKYAN-SDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQV-- 124
            ...:::||||:.||...||: .|..||.||..||::...|.:..:    :||..:..|.|..|  
plant    61 RLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHT----NLRPGASGYVLNSVLA 121

  Fly   125 -----SLVPK--EKVDNI-KDAYGHLENF--LGDNPYLT-GSQLTIADLCCGATASSLAAVLDLD 178
                 .|.||  .:.:|| .::...||.|  .|...:|. |.|.:||||........|..:.|.|
plant   122 PALGLPLNPKAAAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKD 186

  Fly   179 ELK----YPKVAAWFE--RLSKLPHYEE 200
            .|:    :.||..|.|  |.:.:||.:|
plant   187 RLRLLSPHKKVEQWIESTRKATMPHSDE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 62/216 (29%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/78 (28%)
GST_C_Delta_Epsilon 94..209 CDD:198287 36/126 (29%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 22/80 (28%)
GST_C_Theta 92..221 CDD:198292 36/127 (28%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.