DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTT1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:217 Identity:61/217 - (28%)
Similarity:94/217 - (43%) Gaps:24/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWD 68
            ||.:|...:|.|.||..:..:...:.::...:.|.........|...||...||.:.|....:::
plant     3 KLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKLFE 67

  Fly    69 SHAIVCYLVDKYAN-SDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQV-------S 125
            ||||:.||...:.: :|..||.||..||::...|.:..:    :||..:..|.|..|       .
plant    68 SHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHT----NLRRGAAGYVLNSVLGPALGLP 128

  Fly   126 LVPK---EKVDNIKDAYGHLENF--LGDNPYLTGS-QLTIADLCCGATASSLAAVLDLDELK--- 181
            |.||   |....:..:...||.|  .|:..:|.|| |.:||||........|..:.|.|.|:   
plant   129 LNPKAAAEAEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLS 193

  Fly   182 -YPKVAAWFERLSK--LPHYEE 200
             :.||..|.|...|  :||::|
plant   194 THKKVEQWIENTKKATMPHFDE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 57/210 (27%)
GST_N_Delta_Epsilon 5..78 CDD:239343 19/72 (26%)
GST_C_Delta_Epsilon 94..209 CDD:198287 36/126 (29%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 19/74 (26%)
GST_C_Theta 93..223 CDD:198292 36/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.