DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTF12

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:225 Identity:55/225 - (24%)
Similarity:94/225 - (41%) Gaps:53/225 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQH-------TVPLLEDNGA 64
            |||...:...:...|......:::|...:||       |.|.:|.|:|       .||.:||...
plant     5 LYGQVTAACPQRVLLCFLEKGIEFEIIHIDL-------DTFEQKKPEHLLRQPFGQVPAIEDGDF 62

  Fly    65 LIWDSHAIVCYLVDKYAN-SDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYF--LRQ--- 123
            .:::|.||..|...|:|: ...|..:.|..||.|||            ..:|...||  |.|   
plant    63 KLFESRAIARYYATKFADQGTNLLGKSLEHRAIVDQ------------WADVETYYFNVLAQPLV 115

  Fly   124 VSLVPKEK---------VDNIK-------DAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLA 172
            ::|:.|.:         |:::|       |.|   .|.|..|.:|.|.:.|:|||........|.
plant   116 INLIIKPRLGEKCDVVLVEDLKVKLGVVLDIY---NNRLSSNRFLAGEEFTMADLTHMPAMGYLM 177

  Fly   173 AVLDLDELKYPKVA--AWFERLSKLPHYEE 200
            ::.|::::...:.:  .|:|.:|..|.:::
plant   178 SITDINQMVKARGSFNRWWEEISDRPSWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 54/219 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/77 (26%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/130 (24%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 55/225 (24%)
GST_N_Phi 2..77 CDD:239351 20/78 (26%)
GST_C_Phi 91..209 CDD:198296 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.