DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTF8

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:233 Identity:58/233 - (24%)
Similarity:100/233 - (42%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHA 71
            ::|:.:|........||...:|.:|...:|:.||.|.::|.|..||...:|.|||....:::|.|
plant    54 VHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTLFESRA 118

  Fly    72 IVCYLVDKYANSDE-LYPRD---------LVLRAQVDQRLFFDASILFMSLRNV--------SIP 118
            |..||.::|:...| |..:|         :.|:.:..|   ||.:...::...|        :.|
plant   119 ITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQ---FDPNASKLAFERVFKGMFGMTTDP 180

  Fly   119 YFLRQVSLVPKEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAV---LDLDEL 180
            ..::::    :.|:..:.|.|   |..|..:.:|.|...|:|||      ..|.|:   |..|..
plant   181 AAVQEL----EGKLQKVLDVY---EARLAKSEFLAGDSFTLADL------HHLPAIHYLLGTDSK 232

  Fly   181 ----KYPKVAAWFERLSKLPHYEEDNLRGLKKYINLLK 214
                ..|||:.|.:::|..|.:        .|.|:|.|
plant   233 VLFDSRPKVSEWIKKISARPAW--------AKVIDLQK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 53/213 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/70 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 26/129 (20%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.