DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTF10

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:210 Identity:54/210 - (25%)
Similarity:99/210 - (47%) Gaps:20/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDS 69
            |.:|....:...||. :||....:.:|...:||:.|:..:..:|...|...:|:|.|....|::|
plant     3 LTIYAPLFASSKRAV-VTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFES 66

  Fly    70 HAIVCYLVDKY-ANSDELYPRDLVLRAQVDQRLFFDAS-----ILFMSLRNVSIPYF----LRQV 124
            .||:.|:.:|| :...:|..:.:..|.||:|.|..:|:     :|.::|..|..|..    ..:|
plant    67 RAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKV 131

  Fly   125 SLVPKEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLD----LDELKYPKV 185
            ....:||:..:.|.|   |..|..|.||.|..:::|||........|...:.    :.:.|:  |
plant   132 IKESEEKLAEVLDVY---EAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKH--V 191

  Fly   186 AAWFERLSKLPHYEE 200
            :||::::|....::|
plant   192 SAWWDKISSRAAWKE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 53/204 (26%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/120 (26%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 54/210 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_103768
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.