DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTF3

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:215 Identity:55/215 - (25%)
Similarity:83/215 - (38%) Gaps:31/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHA 71
            ::|...|...|...:.|...|||:|...::|..|:|.|:.||.:||...||..||....:::|.|
plant     6 VFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRA 70

  Fly    72 IVCYLVDKYAN-SDELYPRD---------LVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSL 126
            |..|:..:|.| ...|.|.|         :.:..||:...|...:......:.....|.|.....
plant    71 ITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNTDQA 135

  Fly   127 VPKE---KVDNIKDAYGHLENFLGDNPYLTGSQLTIADL--------CCGATASSLAAVLDLDEL 180
            |..|   |:..:.|.|   |..|.:..||.|...|:.||        ..|.....|..       
plant   136 VVAEEEAKLAKVLDVY---EARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKKLFT------- 190

  Fly   181 KYPKVAAWFERLSKLPHYEE 200
            :.|:|..|...::|.|..|:
plant   191 ERPRVNEWVAEITKRPASEK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 53/209 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 24/70 (34%)
GST_C_Delta_Epsilon 94..209 CDD:198287 26/118 (22%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 55/215 (26%)
GST_N_Phi 4..78 CDD:239351 24/71 (34%)
GST_C_Phi 96..212 CDD:198296 26/125 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.