DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:285 Identity:56/285 - (19%)
Similarity:97/285 - (34%) Gaps:96/285 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIW 67
            :.||||....|...:..:|.:....|..|.:::.|...:|.:..|::.|....||::.....:|.
Human    45 ESLVLYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIIS 109

  Fly    68 DSHAIVCYL------------------------------------------------------VD 78
            |...|:.|:                                                      :|
Human   110 DYDQIIDYVERTFTGGGRGRCPSGFPAQPLAVPTEHVVALMPEVGSLQHARVLQYRELLDALPMD 174

  Fly    79 KYANSDELYPRDLVLRAQVD-------QRLFFDASILFMSLRN-----VSIPYFLRQVSLVPK-- 129
            .|.:...|:| :|...:.:.       :|...:|:...|.|.:     :|.||..:|..|:.|  
Human   175 AYTHGCILHP-ELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKIL 238

  Fly   130 --EKVDNIKDAYGHLENFLG-----------DNP------YLTGSQLTIADLCCGATASSLAAVL 175
              :.|..:|...|.|...|.           :|.      :|.|...|:||:..|||...| ..|
Human   239 EHDDVSYLKKILGELAMVLDQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRL-KFL 302

  Fly   176 DLDELKY------PKVAAWFERLSK 194
            .|.: ||      |.:.::|||:.:
Human   303 GLSK-KYWEDGSRPNLQSFFERVQR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 56/283 (20%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/126 (14%)
GST_C_Delta_Epsilon 94..209 CDD:198287 33/140 (24%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 56/283 (20%)
GST_N_GDAP1 47..119 CDD:239350 18/71 (25%)
GST_C_GDAP1L1 220..330 CDD:198335 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.