DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gdap1l1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001072239.1 Gene:gdap1l1 / 779687 XenbaseID:XB-GENE-950543 Length:364 Species:Xenopus tropicalis


Alignment Length:266 Identity:56/266 - (21%)
Similarity:95/266 - (35%) Gaps:78/266 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIW 67
            |.||||....|...:..:|.:.......:.:::.|...:|.:..|::.|....||::.....:|.
 Frog    43 DTLVLYHWTQSFSSQKIRLVIAEKGFPCDERDVSLPLTEHKEPWFMRLNLGEEVPVVIHGDNIIS 107

  Fly    68 DSHAIVCYLVDKYANSDELYPR-----DLVLRAQVDQ------RLFFDA----SILFMSLRNVSI 117
            |.:.|:.|:.:.:..  ||.|:     :.:..::|.|      :|..||    .||...|...|:
 Frog   108 DYNQIIDYIENNFVG--ELIPKLIPETETIFHSRVLQYREILDKLPMDAYTHGCILHPELTTDSM 170

  Fly   118 --------------------------------PYFLRQVSLVPK-EKVDNIK------------- 136
                                            ||..:|..|:.| .:.||:.             
 Frog   171 IPKYATAEIRRHLANASTELTKLDHEEPQLMEPYLSKQKKLMAKILEHDNVNYLTKILIQLSMVL 235

  Fly   137 -DAYGHLE----NFLGD--NPYLTGSQLTIADLCCGATASSLAAVLDLDELKY------PKVAAW 188
             .....||    .:.|.  ..:|.|...|:||:..|||...| ..|.|.: ||      |.:..:
 Frog   236 DQIEAELEKRKLEYEGQKCELWLCGHIFTLADVLLGATLHRL-KFLGLSK-KYWEDGSRPNLQLF 298

  Fly   189 FERLSK 194
            |:|:.|
 Frog   299 FDRIQK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 55/264 (21%)
GST_N_Delta_Epsilon 5..78 CDD:239343 16/72 (22%)
GST_C_Delta_Epsilon 94..209 CDD:198287 36/170 (21%)
gdap1l1NP_001072239.1 Thioredoxin_like 45..117 CDD:381987 16/71 (23%)
GST_C_family 198..308 CDD:383119 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.