Sequence 1: | NP_611324.1 | Gene: | GstE2 / 37107 | FlyBaseID: | FBgn0063498 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001072239.1 | Gene: | gdap1l1 / 779687 | XenbaseID: | XB-GENE-950543 | Length: | 364 | Species: | Xenopus tropicalis |
Alignment Length: | 266 | Identity: | 56/266 - (21%) |
---|---|---|---|
Similarity: | 95/266 - (35%) | Gaps: | 78/266 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 DKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIW 67
Fly 68 DSHAIVCYLVDKYANSDELYPR-----DLVLRAQVDQ------RLFFDA----SILFMSLRNVSI 117
Fly 118 --------------------------------PYFLRQVSLVPK-EKVDNIK------------- 136
Fly 137 -DAYGHLE----NFLGD--NPYLTGSQLTIADLCCGATASSLAAVLDLDELKY------PKVAAW 188
Fly 189 FERLSK 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE2 | NP_611324.1 | GstA | 5..196 | CDD:223698 | 55/264 (21%) |
GST_N_Delta_Epsilon | 5..78 | CDD:239343 | 16/72 (22%) | ||
GST_C_Delta_Epsilon | 94..209 | CDD:198287 | 36/170 (21%) | ||
gdap1l1 | NP_001072239.1 | Thioredoxin_like | 45..117 | CDD:381987 | 16/71 (23%) |
GST_C_family | 198..308 | CDD:383119 | 27/109 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |