DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Gsto2

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:225 Identity:50/225 - (22%)
Similarity:93/225 - (41%) Gaps:60/225 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGA-LIWDSH 70
            :|.|...|.....:|.|:|..:.:|...::|.:.   .|.:..|:|...:|:||::.. |:::| 
Mouse    26 IYSMRFCPYSHRARLVLKAKGIRHEVININLKSK---PDWYYTKHPFGQIPVLENSQCQLVYES- 86

  Fly    71 AIVC-YLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFL--------RQVSL 126
            .|.| ||.|.|... :|:|.|...||:  |::..:   ||..:..:|....:        ..:.:
Mouse    87 VIACEYLDDVYPGR-KLFPYDPYERAR--QKMLLE---LFCKVPPLSKECLIALRCGRDCTDLKV 145

  Fly   127 VPKEKVDNIKD--AYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWF 189
            ..::::.|:::  .|.:...|.||                        .:..:|.|.:|    ||
Mouse   146 ALRQELCNMEEILEYQNTTFFGGD------------------------CISMIDYLVWP----WF 182

  Fly   190 ERLSKLPHYEEDNLRGLKKYINLLKPVLNL 219
            |||         ::.||...:| ..|:|.|
Mouse   183 ERL---------DVYGLADCVN-HTPMLRL 202

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 44/200 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 94..209 CDD:198287 21/124 (17%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 19/71 (27%)