DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Eef1e1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_079656.1 Gene:Eef1e1 / 66143 MGIID:1913393 Length:174 Species:Mus musculus


Alignment Length:190 Identity:46/190 - (24%)
Similarity:71/190 - (37%) Gaps:44/190 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLE-DNGALIWDSHAIVCYLVDKYA 81
            |....||.|.     |.:.|..|:.:     ....:..:|:|: :||..:.....|..:|| |.|
Mouse     2 AAAAELRLLE-----KSLGLKPGNKY-----SAQGERQIPVLQTNNGPSLMGLSTIATHLV-KQA 55

  Fly    82 NSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLV----PKEKVDN-IKDAYGH 141
            :.:.|.......:|.|.|.|.|                   :|:.|    .||.... :||    
Mouse    56 SKEHLLGSTAEEKAMVQQWLEF-------------------RVTRVDGHSSKEDTQTLLKD---- 97

  Fly   142 LENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDEL-KYPKVAAWFERLSKLPHYEE 200
            |.::|.|..||.|..:|:||:............|.:.|. ||..|:.||   ..:.||.:
Mouse    98 LNSYLEDKVYLAGHNITLADILLYYGLHRFIVDLTVQEKEKYLNVSRWF---CHIQHYPD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 44/184 (24%)
GST_N_Delta_Epsilon 5..78 CDD:239343 13/60 (22%)
GST_C_Delta_Epsilon 94..209 CDD:198287 29/113 (26%)
Eef1e1NP_079656.1 N-terminal. /evidence=ECO:0000250 2..56 15/64 (23%)
Linker. /evidence=ECO:0000250 57..63 1/5 (20%)
C-terminal. /evidence=ECO:0000250 64..152 27/113 (24%)
GST_C_AIMP3 65..165 CDD:198338 29/116 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.