DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and eef1e1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:208 Identity:54/208 - (25%)
Similarity:84/208 - (40%) Gaps:54/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHT------VPLLE-DNGALIWDSHAIVCYLVD 78
            :.||.||      .::...|       |||..:::      ||:|: :||..:.....|.|:|| 
Zfish     1 MALRELN------SLERFLG-------LKKANKYSTQGGKKVPVLQNNNGPALTGLVTIACHLV- 51

  Fly    79 KYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNI-KDAYGHL 142
            |.|...||...|...||.|.|.|                .:.:.::....||:|..| ||    |
Zfish    52 KEAKRPELLGDDAEQRAVVQQWL----------------EHRITKLDNCSKEEVKVILKD----L 96

  Fly   143 ENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELK-YPKVAAWFERLSKLPHYEEDNLRGL 206
            ..:|.|..||.|:..|:||:........:...|.:.|.: |..|:.||:.:...|        |:
Zfish    97 NRYLEDKVYLAGNVFTLADILMYYGIHHIIVELAIQEKECYLNVSRWFDHIQHYP--------GI 153

  Fly   207 KKYINLLKPVLNL 219
            :.:   |.||:.|
Zfish   154 RHH---LPPVVVL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 48/183 (26%)
GST_N_Delta_Epsilon 5..78 CDD:239343 16/63 (25%)
GST_C_Delta_Epsilon 94..209 CDD:198287 28/116 (24%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 30/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.