DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gstr

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:210 Identity:50/210 - (23%)
Similarity:85/210 - (40%) Gaps:23/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKLVLYGMDISPPVRACKLTLRALNLD-YEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGA 64
            |:..::||....|||.....:.|....|. |::|.:.....:|........||:..:|..:....
Zfish     1 MAQNMLLYWGTGSPPCWRLMIALEEKQLQGYKHKLLSFDKKEHQSPEVKALNPRAQLPTFKHGEI 65

  Fly    65 LIWDSHAIVCYLVDKY-ANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVS-----IPYFLRQ 123
            ::.:|.|...||...: :....|.|.:....|.|.||: |:...|...:..|:     :|...|.
Zfish    66 VVNESFAACLYLESVFKSQGTRLIPDNPAEMALVYQRM-FETENLQQKMYEVAFYDWLVPEGERL 129

  Fly   124 VSLVPKEK---VDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKV 185
            .|.:.:.|   ::.:|...|:||. :|...||.|...::||:.|      ...:.....|:.|| 
Zfish   130 ESALKRNKEKLIEELKLWEGYLEK-MGKGSYLAGKNFSMADVVC------FPVIAYFPRLQCPK- 186

  Fly   186 AAWFERLSKLPHYEE 200
                ||..:|..|.|
Zfish   187 ----ERCPRLMEYYE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 46/200 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 17/73 (23%)
GST_C_Delta_Epsilon 94..209 CDD:198287 30/115 (26%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 49/206 (24%)
GST_N_family 5..78 CDD:238319 16/72 (22%)
GST_C_family 99..199 CDD:198286 29/112 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589754
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.