DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gdap1l1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:265 Identity:58/265 - (21%)
Similarity:98/265 - (36%) Gaps:76/265 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIW 67
            |:||||....|...:..:|.:....|..|.:::.|...:..:..|::.|....||:......::.
Zfish    46 DRLVLYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVS 110

  Fly    68 DSHAIVCYL-----------------------------------VDKYANSDELYPR---DLVL- 93
            |.:.|:.|:                                   :|.|.:...|:|.   |.:: 
Zfish   111 DYNQIIDYIETNFVGDTVAQLIPDEGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTTDSMIP 175

  Fly    94 ---RAQVDQRLFFDASILFMSLRN----VSIPYFLRQVSLVPK----EKVDNIKDAYGHLENFLG 147
               .|::.:.|...||.| |.|.:    ::.||..:|..|:.|    :.|:.:|...|.|...|.
Zfish   176 KYATAEIRRHLANAASEL-MKLDHEEPQLTEPYLSKQKKLMAKILDHDNVNYLKKILGELAMVLD 239

  Fly   148 D-----------------NPYLTGSQLTIADLCCGATASSLAAVLDLDELKY------PKVAAWF 189
            .                 ..:|.|...|:||:|.|||...| ..|.|.. ||      |.:.::|
Zfish   240 QVEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRL-KFLGLSR-KYWEDGSRPNLQSFF 302

  Fly   190 ERLSK 194
            ||:.|
Zfish   303 ERVQK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 57/263 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 16/107 (15%)
GST_C_Delta_Epsilon 94..209 CDD:198287 36/132 (27%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 57/263 (22%)
Thioredoxin_like 48..120 CDD:294274 16/71 (23%)
GST_C_GDAP1L1 201..311 CDD:198335 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.