Sequence 1: | NP_611324.1 | Gene: | GstE2 / 37107 | FlyBaseID: | FBgn0063498 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_687373.1 | Gene: | gdap1l1 / 562163 | ZFINID: | ZDB-GENE-080812-2 | Length: | 367 | Species: | Danio rerio |
Alignment Length: | 265 | Identity: | 58/265 - (21%) |
---|---|---|---|
Similarity: | 98/265 - (36%) | Gaps: | 76/265 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 DKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIW 67
Fly 68 DSHAIVCYL-----------------------------------VDKYANSDELYPR---DLVL- 93
Fly 94 ---RAQVDQRLFFDASILFMSLRN----VSIPYFLRQVSLVPK----EKVDNIKDAYGHLENFLG 147
Fly 148 D-----------------NPYLTGSQLTIADLCCGATASSLAAVLDLDELKY------PKVAAWF 189
Fly 190 ERLSK 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE2 | NP_611324.1 | GstA | 5..196 | CDD:223698 | 57/263 (22%) |
GST_N_Delta_Epsilon | 5..78 | CDD:239343 | 16/107 (15%) | ||
GST_C_Delta_Epsilon | 94..209 | CDD:198287 | 36/132 (27%) | ||
gdap1l1 | XP_687373.1 | GstA | 48..314 | CDD:223698 | 57/263 (22%) |
Thioredoxin_like | 48..120 | CDD:294274 | 16/71 (23%) | ||
GST_C_GDAP1L1 | 201..311 | CDD:198335 | 29/109 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589687 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |