DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gdap1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:224 Identity:54/224 - (24%)
Similarity:97/224 - (43%) Gaps:36/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALI 66
            :.||:||....|...:..:|.:....|..|..::.|...:|.:..|::.||...||:|..:..:|
Zfish    37 ASKLILYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVI 101

  Fly    67 WDSHAIVCYLVDKYAN--SDELYPRD---LVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSL 126
            .|...|:.||...:.:  :.:|.|.:   ...|.|..:.|          |.::.:..:.....|
Zfish   102 CDPTQIMDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYREL----------LDSLQMDAYTHGCIL 156

  Fly   127 VPKEKVDNIKDAYG--HLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWF 189
            .|:..||:...||.  |:...:|:    |.|:|           ..||  ::..:||...:|...
Zfish   157 HPEITVDSHIPAYATTHIRTQIGN----TESEL-----------KKLA--VENPDLKDAYIAKQR 204

  Fly   190 ERLSKLPHYEEDNLRGLKKYINLLKPVLN 218
            ...|||  ::.||::.|||.::.|:.||:
Zfish   205 RLKSKL--FDHDNMKYLKKLLDELENVLD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 44/197 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 94..209 CDD:198287 27/116 (23%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 53/221 (24%)
GST_N_GDAP1 40..112 CDD:239350 19/71 (27%)
GST_C_family 193..304 CDD:295467 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589741
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.