DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and CLIC5

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001107558.1 Gene:CLIC5 / 53405 HGNCID:13517 Length:410 Species:Homo sapiens


Alignment Length:211 Identity:45/211 - (21%)
Similarity:77/211 - (36%) Gaps:73/211 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LEDNGAL------------IWDSHAIVCYLVDKYANSDELYPRD---------LVLRAQVD---- 98
            |::||::            |..|.|........|::::.|..::         |.::|.:|    
Human   124 LQENGSVMKEDLPSPSSFTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVKAGIDGESI 188

  Fly    99 ------QRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNIKDAYGHLENFLGDN--PYLTGS 155
                  ||||     :.:.|:.|     :..|:.|      ::|.....|.|.....  |:||.:
Human   189 GNCPFSQRLF-----MILWLKGV-----VFNVTTV------DLKRKPADLHNLAPGTHPPFLTFN 237

  Fly   156 QLTIADLCCGATASSLAAVLD--LDELKYPKVA--------AWFERLSKLPHY-----EEDNL-- 203
            .....|:      :.:...|:  |...||||:|        |..:..||...|     :::|.  
Human   238 GDVKTDV------NKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAAL 296

  Fly   204 -RGLKKYINLLKPVLN 218
             |||.|.:..|...||
Human   297 ERGLTKALKKLDDYLN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 36/179 (20%)
GST_N_Delta_Epsilon 5..78 CDD:239343 6/30 (20%)
GST_C_Delta_Epsilon 94..209 CDD:198287 32/144 (22%)
CLIC5NP_001107558.1 O-ClC 173..408 CDD:129941 37/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.