DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and clic5a

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:185 Identity:45/185 - (24%)
Similarity:71/185 - (38%) Gaps:44/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LKKNPQ--HTV------PLLEDNGALIWDSHAIVCYLVDKYANSDELYPRDLVLRAQ------VD 98
            ||:.|.  |.:      |.|..||.:..|.:.|..:|.:..|  ...||:   |.|:      ..
Zfish    52 LKRKPADLHNLAPGTPPPFLTFNGEVRTDVNKIEEFLEEMLA--PPKYPK---LAAKNKESNTAG 111

  Fly    99 QRLFFDASILFMSLR---NVSIPYFLRQV-----SLVPKEKVDNIKDAYGHLENFLGDNPYLTGS 155
            ..:|...|....:.:   |.|:...|.:|     |.:.....|.| ||....|....:..||.|:
Zfish   112 NDIFAKFSAYIKNTKPEANASLEKGLLKVLKKLDSFLNSPLPDEI-DAESTGEEKSSNRKYLDGN 175

  Fly   156 QLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYEEDNLRGLKKYI 210
            :||:||  |..          |.:|...||.:...|..::|    .:|.|:.:|:
Zfish   176 ELTLAD--CNL----------LPKLHVVKVVSKKYRNFEIP----SDLSGVWRYL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 41/169 (24%)
GST_N_Delta_Epsilon 5..78 CDD:239343 11/37 (30%)
GST_C_Delta_Epsilon 94..209 CDD:198287 29/128 (23%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 12/46 (26%)
O-ClC 10..244 CDD:129941 45/185 (24%)
GST_C_CLIC5 104..244 CDD:198330 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.