DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gsto2

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001007373.1 Gene:gsto2 / 492500 ZFINID:ZDB-GENE-041114-67 Length:240 Species:Danio rerio


Alignment Length:236 Identity:62/236 - (26%)
Similarity:100/236 - (42%) Gaps:73/236 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLE-DNGALIWDSH 70
            ||.|...|..:..:|.|.|..:.::...::|::.   .|.||||||..|||:|| .:|.:|::| 
Zfish    25 LYSMRFCPFAQRTRLVLTAKGVKHDIININLVSK---PDWFLKKNPFGTVPVLETSSGQVIYES- 85

  Fly    71 AIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPK------ 129
            .|.|..:|:.....:|.|.|...|||  |:       :.:.|.:..||||.: :|:..|      
Zfish    86 PITCEYLDEVYPEKKLLPSDPFERAQ--QK-------MLLELYSKVIPYFYK-ISMGKKRGEDVS 140

  Fly   130 -------EKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAA 187
                   ||:..:.:|..:.:     ..|..|..:|:                 :|.|.:|    
Zfish   141 TAEAEFTEKLLQLNEALANKK-----TKYFGGDSITM-----------------IDYLIWP---- 179

  Fly   188 WFER---------LSKLPHYEEDNLRGLKKYINLL--KPVL 217
            ||||         |:|.|.        |:|:|.|:  .||:
Zfish   180 WFERAEMMGVKHCLAKTPE--------LRKWIELMFEDPVV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 55/211 (26%)
GST_N_Delta_Epsilon 5..78 CDD:239343 25/71 (35%)
GST_C_Delta_Epsilon 94..209 CDD:198287 28/136 (21%)
gsto2NP_001007373.1 GST_N_Omega 4..93 CDD:239353 25/71 (35%)
GstA 25..210 CDD:223698 60/232 (26%)
GST_C_Omega 107..229 CDD:198293 33/150 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.