DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GstD6

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:213 Identity:73/213 - (34%)
Similarity:124/213 - (58%) Gaps:7/213 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHA 71
            ||.|..||..||..:|.:|:.:::...:::...|:..:..|:|.|||||:|.|.||..:||::.|
  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67

  Fly    72 IVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNIK 136
            ||.|||::|...|.|||:|...:|.::|||:||...|:..:.....| .||......:|.::.:.
  Fly    68 IVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFP-LLRTGKPGTQENLEKLN 131

  Fly   137 DAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKL-PHYEE 200
            .|:..|.|||....|:.|:||::||:...||.|: ..::|.|..|:|.|..|::...|: |.::|
  Fly   132 AAFDLLNNFLDGQDYVAGNQLSVADIVILATVST-TEMVDFDLKKFPNVDRWYKNAQKVTPGWDE 195

  Fly   201 D--NLRGLKKYI--NLLK 214
            :  .::..||::  ||::
  Fly   196 NLARIQSAKKFLAENLIE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 67/189 (35%)
GST_N_Delta_Epsilon 5..78 CDD:239343 28/70 (40%)
GST_C_Delta_Epsilon 94..209 CDD:198287 35/117 (30%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 28/70 (40%)
PLN02395 11..208 CDD:166036 66/198 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 34/117 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460319
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.