DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GstD5

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:217 Identity:77/217 - (35%)
Similarity:109/217 - (50%) Gaps:11/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MDI--SPPVRACK---LTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDS 69
            ||.  ||....|:   :..:||.:....|.::.|..|..|..|:|.|||||:|.|.|||..||:|
  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly    70 HAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDN 134
            .||..|||:||...|.|:|:|...:|.|:|||:||...|:.|......|.| ........|....
  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLF-HTGKPGSDEDFKK 129

  Fly   135 IKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYE 199
            |:.::.:|..||....|:.|..||:||:...:|.|:. .:.|.|..|||.||.|:....|:....
  Fly   130 IESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTF-EIFDFDLNKYPNVARWYANAKKVTPGW 193

  Fly   200 EDNLRGLKKYINLLKPVLNLEQ 221
            |:|.:|..:    ||.|.:..|
  Fly   194 EENWKGAVE----LKGVFDARQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 70/190 (37%)
GST_N_Delta_Epsilon 5..78 CDD:239343 30/72 (42%)
GST_C_Delta_Epsilon 94..209 CDD:198287 36/114 (32%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 69/184 (38%)
GST_N_Delta_Epsilon 1..74 CDD:239343 30/72 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 36/121 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460228
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.