DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gstt1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 / 448525 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis


Alignment Length:205 Identity:56/205 - (27%)
Similarity:96/205 - (46%) Gaps:24/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWD 68
            :|.||...:|.|.|:..:..:|.|:.:...::.|..|:|..:.:.|.|....||.|:|....:.:
 Frog     3 ELTLYLDLLSQPCRSVYIFAKANNIPFNNHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDFFMAE 67

  Fly    69 SHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFF-------DASILFMSLRNVSIPYFLRQVSL 126
            |.|::.|:..|:..:|..||.|:...|:||:.|.:       :.|.:|..  ....|..|.|.: 
 Frog    68 STAMLLYMARKFKTADHWYPSDIQKCAKVDEYLAWQHTNTRPNGSKVFWV--KCLTPLILGQEA- 129

  Fly   127 VPKEKVDNIKDAYGHL-----ENFLGDNPYLTGSQLTIADLCCGATASSLAA----VLDLDELKY 182
             |.||||.:...:...     |.|||:..::.|.::::|||........:.|    |.|    ..
 Frog   130 -PAEKVDAVVAEFNTTMNNFEEKFLGNKLFIAGDEISVADLVAIVEIMQVVAGGINVFD----DR 189

  Fly   183 PKVAAWFERL 192
            ||:|||.:|:
 Frog   190 PKLAAWKKRV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 56/204 (27%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/115 (27%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 20/74 (27%)
GST_C_Theta 92..217 CDD:198292 31/116 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.