DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gsto1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:217 Identity:60/217 - (27%)
Similarity:91/217 - (41%) Gaps:45/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLE-DNGALI 66
            |.:.||.|...|..:..:|.|.|..:.|:...::|   .:..|.||:|||...||:|| .:|.:|
Zfish    21 DHIRLYSMRFCPFAQRTRLVLNAKGIKYDTININL---KNKPDWFLEKNPLGLVPVLETQSGQVI 82

  Fly    67 WDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLR-QVSLVPKE 130
            ::| .|.|..:|:.....:|.|.|...|||  ||:..:   ||..:    .|||.: .|:....|
Zfish    83 YES-PITCEYLDEVYPEKKLLPFDPFERAQ--QRMLLE---LFSKV----TPYFYKIPVNRTKGE 137

  Fly   131 KVD----NIKDAYGHLENFL--GDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWF 189
            .|.    .:||........|  ..:.:..|..:|:                 :|.:.:|    ||
Zfish   138 DVSALETELKDKLSQFNEILLKKKSKFFGGDSITM-----------------IDYMMWP----WF 181

  Fly   190 ERLS--KLPHYEEDNLRGLKKY 209
            |||.  .|.|. .|....|||:
Zfish   182 ERLETMNLKHC-LDGTPELKKW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 53/200 (27%)
GST_N_Delta_Epsilon 5..78 CDD:239343 24/73 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 30/123 (24%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 25/75 (33%)
GstA 25..210 CDD:223698 59/213 (28%)
GST_C_Omega 107..229 CDD:198293 31/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.