DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and clic2

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001002561.2 Gene:clic2 / 436834 ZFINID:ZDB-GENE-040718-299 Length:239 Species:Danio rerio


Alignment Length:181 Identity:41/181 - (22%)
Similarity:58/181 - (32%) Gaps:88/181 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ISPPVRACKLTLRALNLDYEYKEMDLLAGDHFK--DAFLKKNPQ---HTVPLLEDNGALIWDSHA 71
            ::||        |..:|...|||...:..|.|.  .||:|.:|.   |...||.:...|      
Zfish    93 LAPP--------RYPHLSPRYKESFDVGADIFAKFSAFIKNSPNNAFHEKALLREFKRL------ 143

  Fly    72 IVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNIK 136
                  |.|.|:.        |:.::||              |:|          |.|.|     
Zfish   144 ------DDYLNTP--------LQDELDQ--------------NIS----------VSKRK----- 165

  Fly   137 DAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAA 187
                          :|.|::||:||  |..          |.:|...||||
Zfish   166 --------------FLDGNRLTLAD--CNL----------LPKLHVIKVAA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 41/181 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 17/70 (24%)
GST_C_Delta_Epsilon 94..209 CDD:198287 20/94 (21%)
clic2NP_001002561.2 O-ClC 11..238 CDD:129941 41/181 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.