DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GstD11

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:218 Identity:76/218 - (34%)
Similarity:108/218 - (49%) Gaps:9/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSH 70
            |||.:..|||.|:..|..:.|::|:|.|.:::|.|:..|..|:..||||.||.:.|.|.::|:|.
  Fly    26 VLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESR 90

  Fly    71 AIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDNI 135
            ||:.|||..|..||:|||.|:.:||.|||||.||...|:|.|.:...|.......| .:.|...:
  Fly    91 AILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPL-DEGKRAKL 154

  Fly   136 KDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPH--- 197
            .:|.|.|...|....:......|||||....|.|.|.| .:.:...|..:..|.:|..  .|   
  Fly   155 AEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEA-FEFELRPYKHIRQWLDRCK--DHMAP 216

  Fly   198 --YEEDNLRGLKKYINLLKPVLN 218
              |||.|........::.|..:|
  Fly   217 FDYEELNANKANMLADMFKAKMN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 69/189 (37%)
GST_N_Delta_Epsilon 5..78 CDD:239343 30/71 (42%)
GST_C_Delta_Epsilon 94..209 CDD:198287 36/119 (30%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 30/71 (42%)
GST_C_Delta_Epsilon 112..231 CDD:198287 36/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.