DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GstD9

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:219 Identity:87/219 - (39%)
Similarity:119/219 - (54%) Gaps:9/219 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDS 69
            |..|.|..|.|.|:..:|.|||.|:...|::||.||:|.|..|:|.|||||:|.|.|:|..||:|
  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66

  Fly    70 HAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKVDN 134
            .||:.||.:||.....|||:|...||.::||||||.|.|:.|......|.....|. .|.:. ||
  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVK-KPADP-DN 129

  Fly   135 IK---DAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSK-L 195
            :|   ||:......|....|...::||:||....||.|:. .:.:.|..|||:|..|::...| :
  Fly   130 LKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTF-EISEYDFGKYPEVVRWYDNAKKVI 193

  Fly   196 PHYEEDNLRGLKKYINL-LKPVLN 218
            |.:|| |..|.:.|..| |..:||
  Fly   194 PGWEE-NWEGCEYYKKLYLGAILN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 77/194 (40%)
GST_N_Delta_Epsilon 5..78 CDD:239343 36/72 (50%)
GST_C_Delta_Epsilon 94..209 CDD:198287 40/118 (34%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 36/72 (50%)
GstA 4..187 CDD:223698 75/185 (41%)
GST_C_Delta_Epsilon 89..207 CDD:198287 40/121 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460293
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_103768
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.