DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gstt1b

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:230 Identity:68/230 - (29%)
Similarity:115/230 - (50%) Gaps:30/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLYGMDI-SPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWD 68
            |.:| :|: |.|.|:..:..:..|:.::||::.|..|..:.:.|.|.||....|.::|....:.:
Zfish     3 LEIY-LDLFSQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAE 66

  Fly    69 SHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFD--------ASILFMSLRNVSIPYFLRQVS 125
            |.||:.||.||:...|..:|.||..||:|::.|.:.        |.|::.   .:.||..|.  :
Zfish    67 SVAIMIYLADKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWF---KILIPEVLG--A 126

  Fly   126 LVPKEKVDNIKDAYG-----HLENFLGDNPYLTGSQLTIADL-CCGATASSLAAVLDLDELKYPK 184
            .|||||::|.::...     ..:.||.|.|::.|.|:::||| .........||.:|:.|.: ||
Zfish   127 EVPKEKMENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFENR-PK 190

  Fly   185 VAAWFERL-----SKL---PHYEEDNLRGLKKYIN 211
            :.||.:|:     :||   .|....:||...|.|:
Zfish   191 LKAWKDRVRVAIGAKLFDEAHQATMSLRDNAKIID 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 63/213 (30%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/73 (30%)
GST_C_Delta_Epsilon 94..209 CDD:198287 38/136 (28%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 61/202 (30%)
GST_N_Theta 3..78 CDD:239348 23/75 (31%)
GST_C_Theta 91..217 CDD:198292 36/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10727
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.