DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gstt2

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:200 Identity:57/200 - (28%)
Similarity:92/200 - (46%) Gaps:30/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYL 76
            :|.|.||..:.|:...:.:..:::.:..|:.....|.|.||...||:|||||.::.:|.||:.||
Zfish    14 MSQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAILKYL 78

  Fly    77 VDKYANSDELYPRDLVLRAQVDQ-------RLFFDASILFMSLRNVSIPYFLRQVSLVPK-EK-V 132
            ...|...|..||:....||:||:       .....|:.:|.  :.|.:|....|.:...| || :
Zfish    79 ATTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAATVFW--QEVLLPLMTGQPANTAKLEKAL 141

  Fly   133 DNIKDAYGHLEN-FLGDNPYLTGSQLTIADLCCGATASSLAAVLDL--------DELK-YPKVAA 187
            .::......||| ||....:|.|..:::||         |.|:.:|        |.|| .||:.:
Zfish   142 SDLSGTLDKLENMFLKRQAFLCGDDISLAD---------LLAICELMQPMSSGRDILKDRPKLLS 197

  Fly   188 WFERL 192
            |..|:
Zfish   198 WRSRV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 57/199 (29%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/65 (34%)
GST_C_Delta_Epsilon 94..209 CDD:198287 31/117 (26%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 22/67 (33%)
GST_C_Theta 95..220 CDD:198292 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.