DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and se

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:212 Identity:48/212 - (22%)
Similarity:78/212 - (36%) Gaps:43/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLE---DNGALI 66
            |.||.|...|..:...|.|.|..:.|....::|.....:   .|:||||..||.||   :.|..:
  Fly    22 LRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEW---LLEKNPQGKVPALEIVREPGPPV 83

  Fly    67 WDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRL----------FFDASILFMSLRNVSIPYFL 121
            .....::|..:|:......|||||.:.:.| |:.|          ||.||      ....:..|.
  Fly    84 LTESLLICEYLDEQYPLRPLYPRDPLKKVQ-DKLLIERFRAVLGAFFKAS------DGGDLEPFW 141

  Fly   122 RQVSLVPKEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAV-------LDLDE 179
            ..:.:..:|......:.:|             |.|..|.|.........|..:       .:.|:
  Fly   142 SGLDIYERELARRGTEFFG-------------GEQTGILDYMIWPWCERLELLKLQRGEDYNYDQ 193

  Fly   180 LKYPKVAAWFERLSKLP 196
            .::|::..|.||:.:.|
  Fly   194 SRFPQLTLWLERMKRDP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 47/210 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 21/75 (28%)
GST_C_Delta_Epsilon 94..209 CDD:198287 21/120 (18%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 21/75 (28%)
GstA 22..215 CDD:223698 48/212 (23%)
GST_C_Omega 109..229 CDD:198293 21/122 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.