DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GstE11

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:219 Identity:88/219 - (40%)
Similarity:130/219 - (59%) Gaps:2/219 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGAL 65
            ||.|.:||....|||.||..||..||.|:.:.:.:::.||:|....|||.|.|||:|:|:|||.:
  Fly     1 MSAKPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTI 65

  Fly    66 IWDSHAIVCYLVDKYA--NSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVP 128
            :.|||.|..||.||||  ..|.|||:|...|..||.||::|...||..:|.:..|........||
  Fly    66 VSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVP 130

  Fly   129 KEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLS 193
            .::|..::.||..||:.|.:..||.|.:||||||.|.|:.|:..|...::..::|::..|.:|:.
  Fly   131 SDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQ 195

  Fly   194 KLPHYEEDNLRGLKKYINLLKPVL 217
            .||:|:::|..||...:.|:|.:|
  Fly   196 ALPYYQKNNQEGLDMLVGLVKGLL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 76/192 (40%)
GST_N_Delta_Epsilon 5..78 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 94..209 CDD:198287 40/114 (35%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 76/192 (40%)
GST_N_Delta_Epsilon 5..78 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 94..211 CDD:198287 40/116 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468023
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.