DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GstE6

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:212 Identity:105/212 - (49%)
Similarity:147/212 - (69%) Gaps:1/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWD 68
            ||.|||:|.||||||.||||.||||.|||..:|::|.......:|:||||||||.|||:|..|||
  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWD 67

  Fly    69 SHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMS-LRNVSIPYFLRQVSLVPKEKV 132
            ||||:.|||.|||:||.|||:|.:.||.|||||.|::.::|.: :|::|.....:..:.||||:.
  Fly    68 SHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERY 132

  Fly   133 DNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPH 197
            |.|.:.|..:|.||....|:.|:||||||....::.:||.|.:.||..|||::.||.::|.:||:
  Fly   133 DAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLPY 197

  Fly   198 YEEDNLRGLKKYINLLK 214
            |||.|.:|:::.:.:.|
  Fly   198 YEEANGKGVRQLVAIFK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 96/191 (50%)
GST_N_Delta_Epsilon 5..78 CDD:239343 46/72 (64%)
GST_C_Delta_Epsilon 94..209 CDD:198287 47/115 (41%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 96/191 (50%)
GST_N_Delta_Epsilon 4..77 CDD:239343 46/72 (64%)
GST_C_Delta_Epsilon 91..209 CDD:198287 47/117 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467976
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.900

Return to query results.
Submit another query.