DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GstE5

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster


Alignment Length:212 Identity:103/212 - (48%)
Similarity:146/212 - (68%) Gaps:1/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWD 68
            ||.|||::.||||||.||||.||.|.||:..:::...:...:.:|||||:||||.|||:|..|||
  Fly     3 KLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWD 67

  Fly    69 SHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMS-LRNVSIPYFLRQVSLVPKEKV 132
            ||||:.|||.|||:||.||||||:.||.|||||.|:..::|.: ::.::.|.|...::.:|||:.
  Fly    68 SHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERY 132

  Fly   133 DNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPH 197
            |.|.:.|..:|.||..:.|:.|.||||||....::.:||.|.:::|.||||::..|..||.|||:
  Fly   133 DAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKLPY 197

  Fly   198 YEEDNLRGLKKYINLLK 214
            |||.|.:|.::...:||
  Fly   198 YEEANAKGARELETILK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 93/191 (49%)
GST_N_Delta_Epsilon 5..78 CDD:239343 41/72 (57%)
GST_C_Delta_Epsilon 94..209 CDD:198287 47/115 (41%)
GstE5NP_611327.1 GstA 4..196 CDD:223698 93/191 (49%)
Thioredoxin_like 4..77 CDD:294274 41/72 (57%)
GST_C_Delta_Epsilon 91..209 CDD:198287 47/117 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467974
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.900

Return to query results.
Submit another query.