DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GstE13

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:214 Identity:79/214 - (36%)
Similarity:121/214 - (56%) Gaps:18/214 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLED-NGALIW 67
            |..||....|||.|||.|..:.:.||.|.|.:|....:|..:.|:|.||||.:|:..| :|.:..
  Fly     3 KPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYV 67

  Fly    68 DSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSI--------PYFLRQV 124
            |||||||:||.|||.:|:||||||..||.:|.|:.::..:||..::::..        .|..|.:
  Fly    68 DSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRSL 132

  Fly   125 SLVPKEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWF 189
            :|        ..:||..||:||....::.|::|::||:....|..:|..::.::..|||:...|.
  Fly   133 TL--------CHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWM 189

  Fly   190 ERLSK-LPHYEEDNLRGLK 207
            ||:.| ||..||.||:|.:
  Fly   190 ERMDKLLPDNEEINLKGAR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 71/200 (36%)
GST_N_Delta_Epsilon 5..78 CDD:239343 32/73 (44%)
GST_C_Delta_Epsilon 94..209 CDD:198287 35/123 (28%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 32/73 (44%)
GST_C_Delta_Epsilon 92..211 CDD:198287 35/125 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468003
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.