DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and clic1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:166 Identity:41/166 - (24%)
Similarity:64/166 - (38%) Gaps:52/166 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SDELYPRDLVLRAQVD----------QRLFFDASILFMSLRNVSIPYFLRQVSLVP-KEKVDNIK 136
            |:|....:|.::|..|          ||||     :.:.|:.|:.     .|:.|. |.|.:.:|
Zfish     2 SEEKPEVELFVKAGSDGQSIGNCPFSQRLF-----MVLWLKGVTF-----NVTTVDMKRKPEILK 56

  Fly   137 D-AYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLD--LDELKYPKVA--------AWFE 190
            | |.|....||     |.|:::.       ...:.:...|:  |...|||::|        |..:
Zfish    57 DLAPGAQPPFL-----LYGTEVK-------TDTNKIEEFLEETLCPPKYPRLAACNPESNTAGLD 109

  Fly   191 RLSKLPHY-------EEDNL-RGLKKYINLLKPVLN 218
            ..||...|       ..||| :||.|.:..|...|:
Zfish   110 VFSKFSAYIKNSNPQMNDNLEKGLLKALKKLDDYLS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 32/134 (24%)
GST_N_Delta_Epsilon 5..78 CDD:239343
GST_C_Delta_Epsilon 94..209 CDD:198287 35/144 (24%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 24/111 (22%)
O-ClC 6..241 CDD:129941 39/162 (24%)
GST_C_CLIC1 100..238 CDD:198333 12/46 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.