DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:253 Identity:51/253 - (20%)
Similarity:90/253 - (35%) Gaps:86/253 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYL-------- 76
            :|.:....|..|.:::.|...:|.:..|::.|....||::.....:|.|...|:.|:        
  Rat    65 RLVIAEKGLSCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEH 129

  Fly    77 ---------------------------VDKYANSDELYPRDLVLRAQVD-------QRLFFDASI 107
                                       :|.|.:...|:| :|...:.:.       :|...:|:.
  Rat   130 VVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHP-ELTTDSMIPKYATAEIRRHLANATT 193

  Fly   108 LFMSLRN----VSIPYFLRQVSLVPK--EKVDNIKDAYGHLENFLGD------------------ 148
            ..|.|.:    :|.||..:|..|:.|  |     .|..|:|:..||:                  
  Rat   194 DLMKLDHEEPQLSEPYLSKQKKLMAKILE-----HDDVGYLKKILGELAMVLDQIEAELEKRKLE 253

  Fly   149 ------NPYLTGSQLTIADLCCGATASSLAAVLDLDELKY------PKVAAWFERLSK 194
                  ..:|.|...|:||:..|||...| ..|.|.: ||      |.:.::|||:.:
  Rat   254 NEGQTCELWLCGCAFTLADVLLGATLHRL-KFLGLSK-KYWEDGSRPNLQSFFERVQR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 51/253 (20%)
GST_N_Delta_Epsilon 5..78 CDD:239343 13/92 (14%)
GST_C_Delta_Epsilon 94..209 CDD:198287 33/144 (23%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 13/56 (23%)
GST_C_family 203..313 CDD:413470 29/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.