DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Clic6

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:215 Identity:43/215 - (20%)
Similarity:72/215 - (33%) Gaps:91/215 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFK--DAFLKKNPQHTVPLLEDNG 63
            :.:|||       ||        |...|..::.|.:....|.|.  .||:|...:          
  Rat   456 LEEKLV-------PP--------RYPKLGTQHPESNSAGNDVFAKFSAFIKNTKK---------- 495

  Fly    64 ALIWDSHAIVCYLVDKYANSDELYPRDLVLRA--QVDQRLFFDASILFMSLRNVSIPYFLRQVSL 126
                              :::::|.::| |||  ::|..|            |..:|        
  Rat   496 ------------------DANDIYEKNL-LRALKKLDSYL------------NSPLP-------- 521

  Fly   127 VPKEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFER 191
                  |.| |||...:..:....:|.|.:||:||  |..          |.:|...|:.|...|
  Rat   522 ------DEI-DAYSTEDVTVSQRKFLDGDELTLAD--CNL----------LPKLHIIKIVAKKYR 567

  Fly   192 LSKLPHYEEDNLRGLKKYIN 211
            ..:.|    ..:.|:.:|:|
  Rat   568 GFEFP----SEMTGIWRYLN 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 38/194 (20%)
GST_N_Delta_Epsilon 5..78 CDD:239343 12/74 (16%)
GST_C_Delta_Epsilon 94..209 CDD:198287 25/116 (22%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 43/215 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.