DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Clic2

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:144 Identity:35/144 - (24%)
Similarity:51/144 - (35%) Gaps:44/144 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ISPPVRACKLTLRALNLDYEYKE-----MDLLA--GDHFKDAFLKKNPQHTVPLLEDNGALIWDS 69
            ::||        |..:|..:|||     .:|.|  ..:.|:...:.|......||.:...|    
  Rat    94 LAPP--------RYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLREFKRL---- 146

  Fly    70 HAIVCYLVDKYANS---DELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEK 131
                    |.|.|:   ||:.| |......:.:|||.|...|           .|...||:||..
  Rat   147 --------DDYLNTPLLDEIDP-DSTEERTLSRRLFLDGDQL-----------TLADCSLLPKLN 191

  Fly   132 VDNIKDAYGHLENF 145
            :  ||.|.....:|
  Rat   192 I--IKVAAKKYRDF 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 35/144 (24%)
GST_N_Delta_Epsilon 5..78 CDD:239343 14/72 (19%)
GST_C_Delta_Epsilon 94..209 CDD:198287 14/52 (27%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 0/1 (0%)
GST_N_CLIC 9..99 CDD:239359 2/12 (17%)
O-ClC 12..245 CDD:129941 35/144 (24%)
GST_C_CLIC2 106..244 CDD:198331 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.