| Sequence 1: | NP_611324.1 | Gene: | GstE2 / 37107 | FlyBaseID: | FBgn0063498 | Length: | 221 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001004223.1 | Gene: | Eef1g / 293725 | RGDID: | 1302939 | Length: | 437 | Species: | Rattus norvegicus |
| Alignment Length: | 201 | Identity: | 55/201 - (27%) |
|---|---|---|---|
| Similarity: | 86/201 - (42%) | Gaps: | 33/201 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 RACKLTLRALNLDYEYKEMDLL-AGDHF-------KDAFLKKNPQHTVPLLE-DNGALIWDSHAI 72
Fly 73 VCYLVDKYANSDELYPRDLVLRAQVDQRL-FFDASI-------LFMSLRNVSIPYFLRQVSLVPK 129
Fly 130 EKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSL-AAVLDLD-ELKYPKVAAWFERL 192
Fly 193 SKLPHY 198 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstE2 | NP_611324.1 | GstA | 5..196 | CDD:223698 | 54/197 (27%) |
| GST_N_Delta_Epsilon | 5..78 | CDD:239343 | 22/69 (32%) | ||
| GST_C_Delta_Epsilon | 94..209 | CDD:198287 | 31/115 (27%) | ||
| Eef1g | NP_001004223.1 | GST_N_EF1Bgamma | 4..82 | CDD:239342 | 22/75 (29%) |
| maiA | 5..187 | CDD:273527 | 52/186 (28%) | ||
| GST_C_EF1Bgamma_like | 91..213 | CDD:198290 | 31/116 (27%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 221..268 | ||||
| EF1G | 275..381 | CDD:279041 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||