DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GSTT4

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:247 Identity:61/247 - (24%)
Similarity:111/247 - (44%) Gaps:62/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLYGMD-ISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWD 68
            |.|| || :|.|.||..:..:..::.:.::.:|||.|.|....::..||...:|.|:|...::.:
Human     3 LELY-MDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSE 66

  Fly    69 SHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQV----SLVPK 129
            |.||:.||..||:......|.|...||:||:         |::.::.:....::::    .|:||
Human    67 SAAILYYLCRKYSAPSHWCPPDPHARARVDE---------FVAWQHTAFQLPMKKIVWLKLLIPK 122

  Fly   130 --------EK----VDNIKDAYGHLEN-FLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDE-- 179
                    ||    |:.:|::....|. ||.|..::||:|:::||         |.||:::.:  
Human   123 ITGEEVSAEKMEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLAD---------LVAVVEMMQPM 178

  Fly   180 -------LKYPKVAAW----------------FERLSKLPHYEEDNLRGLKK 208
                   |...|:|.|                .:||.:|..::...|..:.|
Human   179 AANYNVFLNSSKLAEWRMQVELNIGSGLFREAHDRLMQLADWDFSTLDSMVK 230

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 58/233 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 24/73 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 33/157 (21%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 24/75 (32%)