DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gst2

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:64/204 - (31%)
Similarity:86/204 - (42%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLED---NGALIWDSHAIVCYLVDKY-- 80
            |.|:.|||.||....|...|:......|..||...||.|.|   |...||:|.||:.||.|||  
pombe    20 LALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNNDYTIWESDAILIYLADKYDT 84

  Fly    81 -------ANSDELYPRDLVLRAQVDQRLFFDAS---ILFMSLRNVSIPYFLRQVSLVPKEKVDNI 135
                   .:..|.|        ::.|.|||.||   :::......:..:....||.|.:.: :.|
pombe    85 DRKISLSFDDPEYY--------KLIQYLFFQASGQGVIWGQAGWFNFFHHEPVVSAVTRYR-NEI 140

  Fly   136 KDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAA------------VLDLD-ELKYPKVAA 187
            |...|.||:.|.|..||..::.|||||.......:|..            |..|| |.::||..|
pombe   141 KRVLGVLEDILKDRDYLVANKYTIADLSFIPWNYNLGGLFGEGKFSFKEEVPQLDFEKEFPKAYA 205

  Fly   188 WFERLSKLP 196
            |.:||...|
pombe   206 WNQRLLARP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 63/202 (31%)
GST_N_Delta_Epsilon 5..78 CDD:239343 24/59 (41%)
GST_C_Delta_Epsilon 94..209 CDD:198287 35/119 (29%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 27/63 (43%)
GstA 5..226 CDD:223698 64/204 (31%)
GST_C_Ure2p 96..219 CDD:198326 37/128 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.