DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gst1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:59/194 - (30%)
Similarity:90/194 - (46%) Gaps:21/194 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLED---NGALIWDSHAIVCYLVDKYANSD 84
            |:.|:|.||.:.::....:......|..||...||.|.|   |...||:|.||:.||.|||....
pombe    22 LKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNNDYTIWESDAILIYLADKYDTER 86

  Fly    85 EL-YPRDLVLRAQVDQRLFFDAS---ILFMSLRNVSIPYFLRQVSLVPKEKVDNIKDAYGHLENF 145
            :: .|||.....:|.|.|||.||   |::......|:.:....:|.:.:.: :.||...|.||:.
pombe    87 KISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYHQELVISAITRYR-NEIKRVLGVLEDI 150

  Fly   146 LGDNPYLTGSQLTIADLCCGATASSLAAVL------------DLD-ELKYPKVAAWFERLSKLP 196
            |.|..||..::.|||||...:..:.|..:.            .|| |.::|:..:|.:||...|
pombe   151 LKDRDYLVANRFTIADLSFISWNNFLEIIFAEGKFSIEEEVPQLDFEKEFPRTYSWHQRLLARP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 58/192 (30%)
GST_N_Delta_Epsilon 5..78 CDD:239343 20/57 (35%)
GST_C_Delta_Epsilon 94..209 CDD:198287 33/119 (28%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 23/61 (38%)
GstA 5..218 CDD:223698 59/194 (30%)
GST_C_Ure2p 96..219 CDD:198326 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.