DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and GstT2

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:215 Identity:62/215 - (28%)
Similarity:99/215 - (46%) Gaps:19/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGAL 65
            ||..:..|...:||..|...:.|:..|...||..:.|...:...|.:.|.|....||.:......
  Fly     1 MSKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFH 65

  Fly    66 IWDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYF-----LRQVS 125
            :.::.||:.||.||....::|||:.|..||:||:.|.:.    .:::|.....||     .....
  Fly    66 LSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQ----HLNIRLACSMYFRDAWLFPMNG 126

  Fly   126 LVPKEKVDNIKDAYGHLENFLG-------DNPYLTGSQLTIADLCCGATASSL-AAVLDLDELKY 182
            :.||.|.:.|:.....:||.||       :|.:|.|..||:||:...:..:.| .....:||.|:
  Fly   127 IAPKPKPEQIQALIEGVENNLGLLERLWLENDFLVGKNLTMADILGSSEINQLRLCQYRVDEKKF 191

  Fly   183 PKVAAWFE--RLSKLPHYEE 200
            |||..|.|  |:|..|:::|
  Fly   192 PKVVKWLERVRVSANPYHDE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 58/205 (28%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/72 (25%)
GST_C_Delta_Epsilon 94..209 CDD:198287 36/122 (30%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 19/74 (26%)
GstA 7..202 CDD:223698 56/198 (28%)
GST_C_family 93..218 CDD:295467 36/123 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460089
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.