DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_659140.2 Gene:Gdap1l1 / 228858 MGIID:2385163 Length:367 Species:Mus musculus


Alignment Length:266 Identity:56/266 - (21%)
Similarity:97/266 - (36%) Gaps:77/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIW 67
            :.||||....|...:..:|.:....|..|.:::.|...:|.:..|::.|....||::.....:|.
Mouse    45 ESLVLYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIIS 109

  Fly    68 DSHAIVCYL-----------------------------------VDKYANSDELYPRDLVLRAQV 97
            |...|:.|:                                   :|.|.:...|:| :|...:.:
Mouse   110 DYDQIIDYVERTFTGEHVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHP-ELTTDSMI 173

  Fly    98 D-------QRLFFDASILFMSLRN-----VSIPYFLRQVSLVPK----EKVDNIKDAYGHLENFL 146
            .       :|...:|:...|.|.:     :|.||..:|..|:.|    :.|..:|...|.|...|
Mouse   174 PKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVL 238

  Fly   147 G-----------DNP------YLTGSQLTIADLCCGATASSLAAVLDLDELKY------PKVAAW 188
            .           :|.      :|.|...|:||:..|||...| ..|.|.: ||      |.:.::
Mouse   239 DQIEAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRL-KFLGLSK-KYWEDGSRPNLQSF 301

  Fly   189 FERLSK 194
            |||:.:
Mouse   302 FERVQR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 56/264 (21%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/107 (17%)
GST_C_Delta_Epsilon 94..209 CDD:198287 33/140 (24%)
Gdap1l1NP_659140.2 GstA 47..314 CDD:223698 56/264 (21%)
GST_N_GDAP1 47..119 CDD:239350 18/71 (25%)
GST_C_family 201..311 CDD:295467 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.