Sequence 1: | NP_611324.1 | Gene: | GstE2 / 37107 | FlyBaseID: | FBgn0063498 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_659140.2 | Gene: | Gdap1l1 / 228858 | MGIID: | 2385163 | Length: | 367 | Species: | Mus musculus |
Alignment Length: | 266 | Identity: | 56/266 - (21%) |
---|---|---|---|
Similarity: | 97/266 - (36%) | Gaps: | 77/266 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 DKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIW 67
Fly 68 DSHAIVCYL-----------------------------------VDKYANSDELYPRDLVLRAQV 97
Fly 98 D-------QRLFFDASILFMSLRN-----VSIPYFLRQVSLVPK----EKVDNIKDAYGHLENFL 146
Fly 147 G-----------DNP------YLTGSQLTIADLCCGATASSLAAVLDLDELKY------PKVAAW 188
Fly 189 FERLSK 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE2 | NP_611324.1 | GstA | 5..196 | CDD:223698 | 56/264 (21%) |
GST_N_Delta_Epsilon | 5..78 | CDD:239343 | 18/107 (17%) | ||
GST_C_Delta_Epsilon | 94..209 | CDD:198287 | 33/140 (24%) | ||
Gdap1l1 | NP_659140.2 | GstA | 47..314 | CDD:223698 | 56/264 (21%) |
GST_N_GDAP1 | 47..119 | CDD:239350 | 18/71 (25%) | ||
GST_C_family | 201..311 | CDD:295467 | 29/109 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844808 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |