DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Gstp3

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_030106733.1 Gene:Gstp3 / 225884 MGIID:2385078 Length:260 Species:Mus musculus


Alignment Length:161 Identity:39/161 - (24%)
Similarity:63/161 - (39%) Gaps:45/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VPLLEDNGALIWDSHAIVCYLVDKYANSDELYPRDLVLRAQVD------QRLFFDASILFMSLRN 114
            :|..:|....::.|:.|:.:|    ..|..||.:|....|.||      :.||          |.
Mouse   103 IPKFQDGELTLYQSNTILRHL----GRSFGLYGKDQQEAALVDMVNDGLEDLF----------RR 153

  Fly   115 VSIPYFLRQVSLVPKEKVDNI-KDAYGHLENF-------LGDNPYLTGSQLTIADLCCGATASSL 171
            ::     ||...:.||..|.. |:..|||:.|       .|...::.|.|::.||.      ..|
Mouse   154 IA-----RQYRHILKEGKDQYQKELPGHLKPFETLLAQNRGGQSFIVGDQISFADY------RLL 207

  Fly   172 AAVLDLDEL------KYPKVAAWFERLSKLP 196
            ..:|:|:.|      .:|..:|:..||...|
Mouse   208 DVLLNLELLFPGYLNDFPLFSAYVARLKSRP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 38/159 (24%)
GST_N_Delta_Epsilon 5..78 CDD:239343 5/21 (24%)
GST_C_Delta_Epsilon 94..209 CDD:198287 30/123 (24%)
Gstp3XP_030106733.1 Thioredoxin_like 63..126 CDD:381987 5/26 (19%)
GST_C_family 134..253 CDD:383119 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.