DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Clic5

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:188 Identity:44/188 - (23%)
Similarity:72/188 - (38%) Gaps:50/188 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LKKNPQ--HTV------PLLEDNGALIWDSHAIVCYLVDKYANSDELYPRDLVLR------AQVD 98
            ||:.|.  |.:      |.|..||.:..|.:.|..:|.:..  :.|.||: |..:      |.:|
Mouse   290 LKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETL--TPEKYPK-LAAKHRESNTAGID 351

  Fly    99 QRLFFDASILFMSLRNVS-----IPYFLRQV-----SLVPKEKVDNIKDAYGHLENFLGDNPYLT 153
            ....|.|.|.....:|.:     :...||::     |.:|:|     .|...|.:.......:|.
Mouse   352 IFSKFSAYIKNTKQQNNAALERGLTKALRKLDDYLNSPLPEE-----IDTNTHGDEKGSQRKFLD 411

  Fly   154 GSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKLPHYE-EDNLRGLKKYI 210
            |.:||:||  |..          |.:|...|:.|     .|..:|: ...:.||.:|:
Mouse   412 GDELTLAD--CNL----------LPKLHVVKIVA-----KKYRNYDIPAEMTGLWRYL 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 40/171 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 11/37 (30%)
GST_C_Delta_Epsilon 94..209 CDD:198287 28/131 (21%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 44/188 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.