DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and Clic6

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_766057.1 Gene:Clic6 / 209195 MGIID:2146607 Length:596 Species:Mus musculus


Alignment Length:215 Identity:43/215 - (20%)
Similarity:71/215 - (33%) Gaps:91/215 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFK--DAFLKKNPQHTVPLLEDNG 63
            :.:|||       ||        |...|..::.|.:....|.|.  .||:|...:          
Mouse   439 LEEKLV-------PP--------RYPKLGTQHPESNSAGNDVFAKFSAFIKNTKK---------- 478

  Fly    64 ALIWDSHAIVCYLVDKYANSDELYPRDLVLRA--QVDQRLFFDASILFMSLRNVSIPYFLRQVSL 126
                              :::|:|.::| |||  ::|..|            |..:|        
Mouse   479 ------------------DANEIYEKNL-LRALKKLDSYL------------NSPLP-------- 504

  Fly   127 VPKEKVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFER 191
                  |.| ||....:..:....:|.|.:||:||  |..          |.:|...|:.|...|
Mouse   505 ------DEI-DADSSEDVTVSQRKFLDGDELTLAD--CNL----------LPKLHIIKIVAKKYR 550

  Fly   192 LSKLPHYEEDNLRGLKKYIN 211
            ..:.|    ..:.|:.:|:|
Mouse   551 DFEFP----SEMTGIWRYLN 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 38/194 (20%)
GST_N_Delta_Epsilon 5..78 CDD:239343 12/74 (16%)
GST_C_Delta_Epsilon 94..209 CDD:198287 24/116 (21%)
Clic6NP_766057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..360
PHA02664 <69..167 CDD:177447
GST_N_CLIC 360..448 CDD:239359 5/23 (22%)
O-ClC 363..596 CDD:129941 43/215 (20%)
GST_C_CLIC6 455..594 CDD:198334 36/184 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.