DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gst-43

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:221 Identity:67/221 - (30%)
Similarity:100/221 - (45%) Gaps:39/221 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDA-FLKKNPQHTVPLLEDNGALIW 67
            |.:||....|......::.|...|:||||:.:||.:.:...:| |:|.||...||.|..||..:.
 Worm     3 KPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLSLT 67

  Fly    68 DSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPKEKV 132
            :|.||:.||       ||.||....|..::|:|.:..|    ::|..|:....|:.:::   .|:
 Worm    68 ESLAIIEYL-------DEAYPDPPFLPKELDKRSYSRA----IALHIVASIQPLQAINI---HKM 118

  Fly   133 DNIKD-AYG-----HLEN--FLG--------DNPYLTGSQLTIADLCCGATASSLAAVLDLDELK 181
            .|.|: .||     |..|  ||.        ...|..|.||||||:...:...: |.:..:|..|
 Worm   119 LNEKEPGYGDFWCNHFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYN-AKIYKVDMSK 182

  Fly   182 YPKVAAWFERLS-----KLPHYEEDN 202
            ||.:....|.|:     ||.|  .||
 Worm   183 YPTITRINEILAEDFRFKLAH--PDN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 62/212 (29%)
GST_N_Delta_Epsilon 5..78 CDD:239343 26/73 (36%)
GST_C_Delta_Epsilon 94..209 CDD:198287 35/130 (27%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 26/79 (33%)
maiA 5..211 CDD:273527 66/219 (30%)
GST_C_Zeta 90..207 CDD:198300 35/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163449
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.