DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE2 and gst-24

DIOPT Version :9

Sequence 1:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:187 Identity:47/187 - (25%)
Similarity:82/187 - (43%) Gaps:28/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDSHAIVCYLVDKYANSDELYPRDLVLRA 95
            |::::.:..|.....|...|.|...:|.|..:|..|..|.||:.||..|:..:.:....:..:.|
 Worm    28 EFEDVRIENGTPEWGALKPKTPFGQLPFLSVDGFEIPQSAAILRYLAKKFGYAGKTSEEEAWVDA 92

  Fly    96 QVDQRLFFDASI--LFMSLRNVSIPYFLRQVSLVPKEKVDNIKDAY-----GHLEN-----FLGD 148
            .|||...|...:  |.|:.|:.:    ..::..:.||.....:|.:     |.||.     .:||
 Worm    93 IVDQFKDFVTPLRQLIMAQRSGN----AEEIERIQKEVFAPARDTFFKILNGILEKSKSGFLVGD 153

  Fly   149 NPYLTGSQLTIADLCCGATASSLAAVLDLDELKY---PKVAAWFERLSKLPHYEEDN 202
            .  :|.:.|.|||:   .|...:..|.|    |:   .|:||..|:::::|..:|.|
 Worm   154 G--VTWADLVIADI---LTTMEMLGVFD----KHGEEQKLAALREKVNEIPEIKEHN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE2NP_611324.1 GstA 5..196 CDD:223698 44/179 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 14/46 (30%)
GST_C_Delta_Epsilon 94..209 CDD:198287 32/124 (26%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 14/46 (30%)
PTZ00057 6..208 CDD:173353 47/187 (25%)
GST_C_Sigma_like 85..191 CDD:198301 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.